PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G23590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 308aa    MW: 34463.8 Da    PI: 5.5458
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G23590.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-192168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd+llv++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  OMERI07G23590.1 21 RGPWTVEEDLLLVNYIAAHGEGRWNALARCAGLKRTGKSCRLRWLNYL 68
                     89********************************************97 PP

2Myb_DNA-binding52.79.7e-1774117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  OMERI07G23590.1  74 RGNMTAEEQLLILELHGRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 117
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6681668IPR017930Myb domain
SuperFamilySSF466897.11E-3119115IPR009057Homeodomain-like
SMARTSM007173.3E-162070IPR001005SANT/Myb domain
PfamPF002494.9E-172168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-232275IPR009057Homeodomain-like
CDDcd001671.84E-122368No hitNo description
PROSITE profilePS5129423.7569123IPR017930Myb domain
SMARTSM007174.8E-1573121IPR001005SANT/Myb domain
PfamPF002492.1E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2276122IPR009057Homeodomain-like
CDDcd001671.33E-1176117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MMMAREVSSE EEAGGGDELR RGPWTVEEDL LLVNYIAAHG EGRWNALARC AGLKRTGKSC  60
RLRWLNYLRP DVRRGNMTAE EQLLILELHG RWGNRWSKIA QHLPGRTDNE IKNYWRTRVQ  120
KHAKHLNCDV NSQQFKDLMR YLWMPRLLER IHRSSQSQSP DADDADLSVS AATSCITSDV  180
VVDAHHPPLA MADSTTSNDS AAMWQQHQAP QMSIAGAPPP TTTTVTQHVV LPAAAASCHQ  240
MQDQFVCARA AETTTPTTTC CWSESESLPG LAGLYYDDVA AALPEFDVET MAMWAPEDDP  300
WYTQMLGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251812124126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1034550.0AK103455.1 Oryza sativa Japonica Group cDNA clone:J033129J22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645266.10.0PREDICTED: myb-related protein 340
TrEMBLA0A0E0EGE50.0A0A0E0EGE5_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g48870.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.16e-81myb domain protein 112